IL-17C Protein, Human (HEK293, His)

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections^[1]. IL-17C Protein, Human (HEK293, His) is a recombinant human IL-17C protein with His tag at the C-terminus and is expressed in HEK293 cells.

Interleukin-17C (IL-17C) belongs to the IL-17 cytokine family. IL-17C is predominantly expressed by epithelial cells.
Human and mouse IL-17C shares 76.68% sequence identity.
IL-17C binds to its functional receptor, a heterodimer formed by IL-17RA and IL-17RE. TLR2, TLR3 and TLR5 upregulate the expression of IL-17C at mucosal surfaces. The expression of IL-17C is also regulated by cytokines (TNF-α, IL-1β and IL-17A). IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides including human beta-defensin 2 (hBD2), Lipocalin 2 (LCN2), and granzyme B. IL-17C also stimulates the release of cytokines (IL-1β, TNF-α, and IL-6).
IL-17C is implicated in autoimmune disorders and bacterial infections^[1].

IL-17C is abundantly expressed in inflamed skin^[2].
IL-17C (100 ng/mL; 16 h) potentiates TNF-α effects and mediates immune cell recruitment by induction of chemokines in keratinocytes^[2].
IL-17C (200 ng/mL; 24 h) and TNF-α (2 ng/mL) induce characteristic psoriasis-related transcriptome genes in both additive and synergistic manners. IL-17C (6 h) increases mRNA expression of TNF-α and IL-6^[3].

Immobilized IL-17C Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind Recombinant Human IL-17RE (C-Fc) . The ED₅₀ of Recombinant Human IL-17RE (C-Fc) is ≤10 ng/mL.

Human

HEK293

C-6*His

Q9P0M4 (H19-V197)

27189  [NCBI]

HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Approximately 19 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM NaAc, 50 mM NaCl, 6% Trehalose, 2%Mannitol, 0.05% Tween 80, pH 5.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Swedik S, et al. IL-17C in human mucosal immunity: More than just a middle child. Cytokine. 2021 Oct;146:155641.  [Content Brief]

  [2]. Lauffer F, et al. IL-17C amplifies epithelial inflammation in human psoriasis and atopic eczema. J Eur Acad Dermatol Venereol. 2020 Apr;34(4):800-809.  [Content Brief]

  [3]. Johnston A, et al. Keratinocyte overexpression of IL-17C promotes psoriasiform skin inflammation. J Immunol. 2013 Mar 1;190(5):2252-62.  [Content Brief]