IL-17D Protein, Human

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. IL-17D Protein, Human is the recombinant human-derived IL-17D protein, expressed by E. coli , with tag free. The total length of IL-17D Protein, Human is 185 a.a., with molecular weight of ~20.0 kDa.

IL-17D protein serves as a potent inducer, effectively triggering the expression of key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF from endothelial cells. This cytokine's ability to stimulate the production of pro-inflammatory signals underscores its significance in orchestrating immune responses, particularly within the context of endothelial cell activation. The induced expression of interleukins and chemokines suggests a crucial role for IL-17D in shaping the inflammatory milieu and contributing to the regulation of immune and inflammatory processes mediated by endothelial cells.

Human

E. coli

Tag Free

Q8TAD2 (A18-P202)

53342  [NCBI]

APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

Approximately 20.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Glycine-HCl, 4% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 3.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.