IL-17F, Rat (sf9, His)

Rat IL-17F is predicted to have cytokine binding and dimerization activities and is involved in bacterial defense, IL-17-mediated signaling, and regulation of cytokine production. It acts upstream of the inflammatory response, and its homologue to human IL17F has been implicated in chronic mucocutaneous candidiasis. IL-17F, Rat (sf9, His) is the recombinant rat-derived IL-17F, Rat, expressed by E. coli , with N-6*His labeled tag. The total length of IL-17F, Rat (sf9, His) is 134 a.a., with molecular weight of ~18 kDa.

IL-17F, Rat is predicted to possess cytokine binding activity, protein dimerization activity, and signaling receptor binding activity. The gene is anticipated to participate in various processes, including the defense response to bacterium, interleukin-17-mediated signaling pathways, and the regulation of cytokine production. It is predicted to act upstream of or within positive regulation of cytokine production involved in the inflammatory response and positive regulation of transcription by RNA polymerase II. The anticipated subcellular location is in the extracellular space. As the ortholog of human IL17F (interleukin 17F), IL-17F, Rat is implicated in chronic mucocutaneous candidiasis. Despite its functional significance, low expression levels have been observed in the reference dataset, suggesting that its regulatory functions may be tightly controlled or context-dependent.

Rat

E. coli

N-6*His

NP_001015011.2 (A28-A161)

301291  [NCBI]

ARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA

Approximately 18 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.