1. Recombinant Proteins
  2. Others
  3. IL-18/IL-1F4 Protein, Porcine

IL-18/IL-1F4 protein is a pro-inflammatory cytokine that is critical in epithelial barrier repair and coordinates immune responses involving Th1 cells and NK cells. IL-18 binds to IL18R1 and IL18RAP to form a ternary complex that activates NF-κ-B and triggers the synthesis of inflammatory mediators. IL-18/IL-1F4 Protein, Porcine is the recombinant Porcine-derived IL-18/IL-1F4 protein, expressed by E. coli , with tag free. The total length of IL-18/IL-1F4 Protein, Porcine is 157 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-18/IL-1F4 protein is a pro-inflammatory cytokine that is critical in epithelial barrier repair and coordinates immune responses involving Th1 cells and NK cells. IL-18 binds to IL18R1 and IL18RAP to form a ternary complex that activates NF-κ-B and triggers the synthesis of inflammatory mediators. IL-18/IL-1F4 Protein, Porcine is the recombinant Porcine-derived IL-18/IL-1F4 protein, expressed by E. coli , with tag free. The total length of IL-18/IL-1F4 Protein, Porcine is 157 a.a., with molecular weight of ~18.0 kDa.

Background

IL-18, a pro-inflammatory cytokine, plays a crucial role in epithelial barrier repair and orchestrates polarized immune responses involving T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, triggering the synthesis of inflammatory mediators. It synergizes with IL-12 to induce IFNG synthesis in Th1 cells and NK cells. Notably, IL-18 is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with the ligand-binding receptor subunit IL18R1 and the signaling receptor subunit IL18RAP, initiating intracellular signaling. The interaction with the cargo receptor TMED10 facilitates IL-18's translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion.

Biological Activity

Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells in the presence of TNF-alpha. The ED50 for this effect is 36.31 ng/mL in the presence of 15 pg/mL TNF-alpha, corresponding to a specific activity is 2.754×104 U/mg.

Species

Porcine

Source

E. coli

Tag

Tag Free

Accession

O19073 (Y36-N192)

Gene ID
Molecular Construction
N-term
IL-18 (Y36-N192)
Accession # O19073
C-term
Synonyms
Interleukin-18; IL-18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma; IGIF; Interleukin 18
AA Sequence

YFGKLEPKLSIIRNLNDQVLFINQGHQAVFEDMPDSDCSDNAPQTVFIIYMYKDSLTRGLAVTISVQCKKMSTLSCKNKTLSFKEMSPPDNIDDEGNDIIFFQRSVPGHDDKIQFESSLYKGYFLACKKENDLFKLILKEKDECGDKSIMFTVQNKN

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 2 mM DTT, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-18/IL-1F4 Protein, Porcine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18/IL-1F4 Protein, Porcine
Cat. No.:
HY-P79202
Quantity:
MCE Japan Authorized Agent: