1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-18
  5. IL-18 Protein, Mouse (solution)

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (solution) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with tag free. The total length of IL-18 Protein, Mouse is 157 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (solution) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with tag free. The total length of IL-18 Protein, Mouse is 157 a.a..

Background

IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and the modulation of immune responses by polarizing T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to its receptors IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, leading to the synthesis of inflammatory mediators. It synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. IL-18 is also involved in transducing inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with IL18R1 and IL18RAP, with IL18 first binding to IL18R1 to form a low affinity binary complex, which then interacts with IL18RAP to form a high affinity ternary complex that signals within the cell. Additionally, IL-18 interacts with the cargo receptor TMED10 to facilitate its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

Biological Activity

Measured by its ability to induce IFN-γ secretion by KG-1 human myelomonocyte and the ED50 is typically 0.1-0.8 μg/mL.

  • Measured by its ability to induce IFN-gamma secretion by KG‑1 human acute myelogenous leukemia cells. The ED50 for this effect is 0.1519 μg/mL, corresponding to a specific activity is 6.583×103 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P70380 (N36-S192)

Gene ID
Molecular Construction
N-term
IL-18 (N36-S192)
Accession # P70380
C-term
Synonyms
Interleukin-18; IFN-gamma-inducing factor; IL-18; IL-1 gamma; Igif; IL-1F4
AA Sequence

NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

IL-18 Protein, Mouse (solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18 Protein, Mouse (solution)
Cat. No.:
HY-P73181
Quantity:
MCE Japan Authorized Agent: