IL-18BP Protein, Human (HEK293, hFc)

IL-18BP Protein belongs to immunoglobulin superfamily that bind to IL-18 and inhibits its activity. IL-18BP Protein functions as an inhibitor of the Th1 cytokine response^[1]. IL-18BP Protein, Human (HEK293, hFc) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-18BP Protein, Human (HEK293, hFc) is 164 a.a., with molecular weight of 55-80 kDa.

IL-18BP Protein is a cytokine receptor that inhibits the binding of IL-18 to its receptor, and thus inhibits IL-18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses^[1]. IL-18BP Protein is constitutively expressed and secreted in mononuclear cells^[2]. Elevated level of IL-18BP Protein is detected in the intestinal tissues of patients with Crohn's disease^[3].

Immobilized Human IL-18 at 5 μg/mL (100 μl/Well) on the plate. Dose response curve for Human IL-18BP, hFc Tag with the EC₅₀ of ≤62.2 ng/mL determined by ELISA .

Human

HEK293

C-hFc

AAD17187.1 (T29-G192)

10068  [NCBI]

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

55-80 kDa

Greater than 95% as determined by reducing SDS-PAGE or Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.