1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-18BP
  5. IL-18BP Protein, Human (HEK293, hFc)

IL-18BP Protein belongs to immunoglobulin superfamily that bind to IL-18 and inhibits its activity. IL-18BP Protein functions as an inhibitor of the Th1 cytokine response. IL-18BP Protein, Human (HEK293, hFc) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-18BP Protein, Human (HEK293, hFc) is 164 a.a., with molecular weight of 55-80 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

IL-18BP Protein, Human (HEK293, hFc) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-18BP Protein, Human (HEK293, hFc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-18BP Protein belongs to immunoglobulin superfamily that bind to IL-18 and inhibits its activity. IL-18BP Protein functions as an inhibitor of the Th1 cytokine response[1]. IL-18BP Protein, Human (HEK293, hFc) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL-18BP Protein, Human (HEK293, hFc) is 164 a.a., with molecular weight of 55-80 kDa.

Background

IL-18BP Protein is a cytokine receptor that inhibits the binding of IL-18 to its receptor, and thus inhibits IL-18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses[1]. IL-18BP Protein is constitutively expressed and secreted in mononuclear cells[2]. Elevated level of IL-18BP Protein is detected in the intestinal tissues of patients with Crohn's disease[3].

Biological Activity

Immobilized Human IL-18 at 5 μg/mL (100 μl/Well) on the plate. Dose response curve for Human IL-18BP, hFc Tag with the EC50 of ≤62.2 ng/mL determined by ELISA .

Species

Human

Source

HEK293

Tag

C-hFc

Accession

AAD17187.1 (T29-G192)

Gene ID
Molecular Construction
N-term
IL-18BP (T29-G192)
Accession # AAD17187.1
hFc
C-term
Synonyms
Interleukin-18-binding protein; IL-18BP; Tadekinig-alfa
AA Sequence

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Molecular Weight

55-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE or Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-18BP Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18BP Protein, Human (HEK293, hFc)
Cat. No.:
HY-P72575
Quantity:
MCE Japan Authorized Agent: