IL-1R1 Protein, Rat (HEK293, His)

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (K_d: 0.1-1 nM). IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB, MAPK pathways ^[1]. IL-1R1 Protein, Rat (HEK293, His) is a recombinant rat extracellular region of IL-1R1 (M1-K352) with a C terminal His tag, which is produced in HEK293 cells.

IL-1R1 (CD121a), a member of IL-1 receptor, is a receptor for IL-1α, IL-1β, IL-1Ra and IL-38, thereby mediating IL-1-dependent activation^[1]. IL-1R1 is mainly expressed in endothelial cells and astrocytes. The neuronal distribution of IL-1R1 is limited in the rat forebrain, and is expressed in the hippocampus, basolateral amygdala and ARH. ^[2].
The sequence of amino acids in IL-1R1 differs in different species. Rats IL-1R1 shares 85.59% aa sequence identity with mouse, and shares <70% aa sequence identity with Human IL-1R1.
IL-1R1 interacts with IL-1α and IL-1β, thereby promoting signal transduction together with IL-1R3 (IL-1RAcP)^[3]. IL-1R1 is important in necrosome formation. IL-1R1 interacts with p-MLKL to trigger neuronal necroptosis after tGCI (global cerebral ischemia)^[4].
IL-1R1 mediates necrosome formation, and immune and inflammatory responses including the activation of NF-κB, MAPK and other pathways.

IL-1R1 (murine, .5 μg/mL) prevents the loss of cell-surface IL-1R1 in Il1rn^−/− blood cells^[6].

Measured by its binding ability in a functional ELISA. Immobilized Rat IL-1R1 at 10 μg/ml (100 μl/well) can bind Human IL-1RN. The ED₅₀ for this effect is 2.163 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat IL-1R1 at 10 μg/mL (100 μL/well) can bind Human IL-1RN. The ED₅₀ for this effect is 2.163 ng/mL.

Rat

HEK293

C-His

NP_037255.3(L34-K352)

25663  [NCBI]

LETDKCTEYPNEVISFSSVNEIDIRSCPLTPNEMHGGTIIWYKNDSKTPISADKDSRIHQQNEHLWFVPAKMEDSGYYYCIMRNSTYCLKTKITMSVLENDPGLCYNTQASFIQRLHVAGDGSLVCPYLDFFKDENNELPKVQWYKNCKPLPLDDGNFFGFKNKLMVMNVAEEHRGNYTCRTSYTYQGKQYPVTRVITFITIDDSKRDRPVIMSPRNETMEADPGSTIQLICNVTGQFTDLVYWKWNGSEIEWDDPILAEDYQFLEHPSAKRKYTLITTLNVSEVKSQFYRYPFICFVKNTHILETAHVRLVYPVPDFK

52-75 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Diana Boraschi, et al. The family of the interleukin-1 receptors. Immunol Rev. 2018 Jan;281(1):197-235.  [Content Brief]

  [2]. Léa Chaskiel, et al. Interleukin-1 reduces food intake and body weight in rat by acting in the arcuate hypothalamus. Brain Behav Immun. 2019 Oct;81:560-573.  [Content Brief]

  [3]. Naoe Kaneko, et al. The role of interleukin-1 in general pathology. Inflamm Regen. 2019 Jun 6;39:15.  [Content Brief]

  [4]. Xiang Chu, et al. Coupling Between Interleukin-1R1 and Necrosome Complex Involves in Hemin-Induced Neuronal Necroptosis After Intracranial Hemorrhage. Stroke. 2018 Oct;49(10):2473-2482.  [Content Brief]

  [5]. Siri Tahtinen, et al. IL-1 and IL-1ra are key regulators of the inflammatory response to RNA vaccines. Nat Immunol. 2022 Apr;23(4):532-542.  [Content Brief]