IL-1RA/IL-1RN Protein, Human

IL-1RA/IL-1RN Protein, Human is a member of the IL-1 family that binds to IL-1 receptors.

The production of Human Interleukin-1 Receptor Antagonist Protein (IL-1ra) is stimulated by many substances including adherent IgG, other cytokines, and bacterial or viral components. Endogenous IL-1Ra is produced in numerous experimental animal models of disease as well as in human autoimmune and chronic inflammatory diseases. Treatment of human diseases with recombinant human IL-1Ra shows an absence of benefit in sepsis syndrome^[1]. IL-1 receptor antagonist (IL-1ra) has provided a tool for blocking IL-1 activity in vivo, leading to a detailed understanding of the role of this cytokine in the inflammatory response^[2].

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED₅₀ for this effect is 0.6883-1.145 ng /mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 8.73×10⁵-1.45×10⁶ units/mg.

• 
  Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED₅₀ for this effect is 0.6883 ng /mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is1.45×10⁶ units/mg.

Human

E. coli

Tag Free

P18510-1 (R26-E177)

3557  [NCBI]

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

15-19 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 8% Trehalose, 4% Mannitol, 50 mM NaCl, 0.05% Tween 80, pH 7.5 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Arend WP, et al. Interleukin-1 receptor antagonist: role in biology. Annu Rev Immunol. 1998;16:27-55.  [Content Brief]

  [2]. Nikolic-Paterson DJ, et al. Interleukin-1 receptor antagonism. Semin Nephrol. 1996 Nov;16(6):583-90.  [Content Brief]

  [3]. Arend WP, et al. Interleukin 1 receptor antagonist. A new member of the interleukin 1 family. J Clin Invest. 1991 Nov;88(5):1445-51.  [Content Brief]