IL-21 Protein, Mouse (His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (His) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IL-21 Protein, Mouse (His) is 122 a.a., with molecular weight of 16 kDa.

IL-21, a cytokine endowed with immunoregulatory prowess, emerges as a key player in orchestrating the delicate transition between innate and adaptive immunity. This multifaceted regulator takes the stage in inducing the production of IgG(1) and IgG(3) in B-cells, thereby substantiating its pivotal role in shaping humoral immune responses. IL-21 finds its niche in fostering the generation and perpetuation of T follicular helper (Tfh) cells and the intricate formation of germinal centers. Collaborating synergistically with IL6, it exercises command over the early development of Tfh cells, contributing indispensably to a robust antibody response during acute viral infections. Beyond B-cells, IL-21 extends its influence to the realm of natural killer (NK) cells, where, in synergy with IL15, it fuels their proliferation and maturation. Further, IL-21 flexes its regulatory muscle, guiding the proliferation and maturation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it orchestrates the production of interferon-gamma in both T-cells and NK cells. Notably, during T-cell-mediated immune responses, IL-21 steps in as a potential inhibitor, dampening the activation and maturation of dendritic cells, unveiling a nuanced regulatory role in immune dynamics.

Mouse

E. coli

N-6*His

Q9ES17 (P25-S146)

60505  [NCBI]

PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

16 KDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 6% Sucrose, 2% Glycine, 50 mM NaCl, 0.05% Tween 80, pH 6.5.

Less than 1 EU/µg as determined by LAL test.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.