IL-22 Protein, Mouse

IL-22 Protein, Mouse plays a prominent role in epithelial regeneration and dampening of chronic inflammatory responses by protecting intestinal stem cells from immune-mediated tissue damage.

Interleukin-22 (IL-22) is a member of the IL-10 family of cytokines, expressed predominantly by subsets of innate lymphoid cells (ILCs) and activated T cells, including T helper 1 (TH1) cells, TH17 cells and TH22 cells. IL-22 can be recognized by a heterodimeric receptor complex that consists of two transmembrane subunits: IL-22R1 and IL-10R2. The binding of IL-22 to its receptor activates the JAK/STAT and MAPK signaling pathway, resulting in gene expression or repression. Since the IL-10R2 is shared by five cytokines (IL-10, IL-22, IL-26, IL-28, and IL-29) and is widely expressed in most cells, the expression of the IL-22R1 determines whether a cell is the target of IL-22. IL-22 has a considerable therapeutic potential in graft-versus-host disease (GVHD), which is a frequent and challenging complication following allogeneic stem cell transplantation^[1].

1.The ED₅₀ is <0.5 ng/mL as measured by COLO 205 cells.
2.Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED₅₀ for this effect is ≤292.3 pg/mL, corresponding to a specific activity is ≥3.42×10⁶ U/mg.

• 
  Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED₅₀ for this effect is 292.3 pg/mL, corresponding to a specific activity is 3.42×10⁶ U/mg.

Mouse

E. coli

Tag Free

Q9JJY9 (L34-V179)

50929  [NCBI]

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Approximately 14-17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.0-7.4 or 50 mM Tris-HCL, 300 mM NaCl, 10 mM Imidazole, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Lin Y, et al. Lactobacillus delivery of bioactive interleukin-22. Microb Cell Fact. 2017 Aug 23;16(1):148.  [Content Brief]