1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors
  4. IL-23
  5. IL-23 alpha
  6. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)

IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78152
Handling Instructions Technical Support

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293 , with C-His, C-Avi labeled tag. The total length of IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is 175 a.a., with molecular weight of 23-28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293 , with C-His, C-Avi labeled tag. The total length of IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is 175 a.a., with molecular weight of 23-28 kDa.

Background

IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.

Species

Mouse

Source

HEK293

Tag

C-His;C-Avi

Accession

Q9EQ14 (V22-A196)

Gene ID
Molecular Construction
N-term
IL-23α (V22-A196)
Accession # Q9EQ14
His-Avi
C-term
Synonyms
Interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; Interleukin-23 subunit p19; IL-23p19; IL23p19; IL23A; P19; SGRF
AA Sequence

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

Molecular Weight

23-28 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78152
Quantity:
MCE Japan Authorized Agent: