IL-25/IL-17E Protein, Rat (HEK293, Fc)

IL-25/IL-17E is a member of the IL-17 family. IL-25/IL-17E Protein, Rat (HEK293, Fc) is the recombinant rat-derived IL-25/IL-17E protein, expressed by HEK293 , with N-hFc labeled tag. The total length of IL-25/IL-17E Protein, Rat (HEK293, Fc) is 153 a.a., with molecular weight of ~50 kDa.

IL-25, also known as IL-17E, is a member of the IL-17 family.

Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED₅₀ for this effect is 0.2944 ng/mL, corresponding to a specific activity is 3.397×10⁶ U/mg.

Rat

HEK293

N-hFc

D3ZLB1 (V17-A169)

501996  [NCBI]

VSLRIQEDCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA

Approximately 50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.