IL-3 Protein, Mouse (HEK293)

IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts. It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes. In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation. IL-3 Protein, Mouse (HEK293) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with tag free.

The cytokine IL-3, predominantly secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, plays a crucial role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Moreover, IL-3 stimulates mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond its hematopoietic functions, IL-3 contributes to neural cell proliferation and survival and participates in bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and a signal transducing subunit IL3RB, leading to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Additionally, IL-3, as a monomer, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK.

Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells and the ED₅₀ is 0.1-0.5 ng/mL.

Mouse

HEK293

Tag Free

P01586 (A27-C166)/NP_034686.2

16187  [NCBI]

MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Approximately 15.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.