IL-32 alpha Protein, Human (HEK293, His)

IL-32 protein is a member of the cytokine family whose expression increases following T cell activation or IL-2-induced NK cell activation. It plays a key role in inducing macrophages to produce TNFα, which contributes to the inflammatory response. IL-32 alphaProtein, Human (HEK293, His) is the recombinant human-derived IL-32 alpha protein, expressed by HEK293 , with C-His labeled tag.

IL-32 Protein, a member of the cytokine family, is characterized by features such as a tyrosine sulfation site, three potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Its expression is notably increased following the activation of T-cells by mitogens or the activation of NK cells by IL-2. IL-32 plays a pivotal role in inducing the production of TNFalpha from macrophage cells, implicating its involvement in inflammatory responses. The gene exhibits alternative transcriptional splice variants, giving rise to different isoforms with distinct functional characteristics. IL-32 demonstrates broad expression across various tissues, with substantial levels observed in the small intestine (RPKM 122.1), spleen (RPKM 121.0), and 22 other tissues, underscoring its diverse roles and potential contributions to immune modulation and tissue-specific functions.

Measured by its ability to induce TNF-alpha secretion by RAW 264.7 mouse monocyte/macrophage cells. The ED₅₀ for this effect is 1.452 μg/mL in the presence of 5 μg/mL MDP. Corresponding to a specific activity is 688.705 U/mg.

Human

HEK293

C-His

P24001-4/NP_001012651 (M1-K131)

9235  [NCBI]

MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

Approximately 19-23 kDa due to the phosphorylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.