IL-36RN Protein, Human

IL-36RN Protein, Human, a member of the interleukin 1 cytokine family, is a IL-36 receptor antagonist.

IL-1F5 (IL-36RN) acts as a receptor antagonist of IL-1RL2 (IL-1Rrp2). It inhibits the multiple stimulatory effects induced by the agonists IL-1F6 (IL-36a), IL-1F8 (IL36b) and IL-1F9 (IL-36c) by preventing them from binding to this receptor. As with IL-1RN, IL-36RN fails to recruit IL-1RAcP on the cell surface. IL-36RN also downregulates inflammation through an interaction with the orphan receptor SIGIRR. Humans possessing a homozygous missense mutation in IL-36RN express low levels of an aberrant protein which has a lower affinity for IL-1RL2 than the wild-type^[1].

Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells and the ED₅₀ is 47.1 ng/mL.

Human

E. coli

Tag Free

Q9UBH0 (V2-D155)

26525  [NCBI]

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. M S Gibson, et al. Identification, cloning and characterisation of interleukin-1F5 (IL-36RN) in the chicken. Dev Comp Immunol. 2012 Sep;38(1):136-47.  [Content Brief]