1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-5 Receptor
  5. IL-5 Receptor α
  6. IL-5R alpha Protein, Mouse (HEK293, His)

IL-5R alpha protein is a cytokine receptor that is expressed on eosinophils, basophils and B cells and is involved in inflammation and immune regulation. IL-5R alpha Protein, Mouse (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein with a C-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-5R alpha protein is a cytokine receptor that is expressed on eosinophils, basophils and B cells and is involved in inflammation and immune regulation. IL-5R alpha Protein, Mouse (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein with a C-6*His tag[1][3].

Background

IL-5R alpha is a type I cytokine receptor consisting of two distinct polypeptide chains, alpha and beta. alpha chain is a membrane-penetrating glycoprotein that specifically binds IL-5 and beta chain converts low affinity IL-5R to high affinity IL-5R, forming a heterodimeric receptor complex[1].
IL-5R alpha can induce the activation of multiple intracellular signalling pathways, including JAK/STAT, RAF/MAP, Ras-Raf-ERK and phosphatidylinositol 3-kinase when its binds with IL-5[2].
IL-5R alpha is expressed on eosinophils, basophils and B cells and affects cell survival, apoptosis, differentiation and chemotaxis[3].

In Vitro

IL-5R alpha expression is increased in myeloma CD34+ cells and facilitates eosinophil production and may further promote the subsequent development of blood and tissue eosinophilia, a hallmark of allergic inflammation[4].

In Vivo

IL-5R alpha plays a key role in the development of airway eosinophilia and bronchial hyperresponsiveness (BHR) in mice, but not in antigen-induced elevation of serum IgE by performing allergen induction in IL-5Rα KO-deficient mice[5].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P21183 (D18-H339)

Gene ID
Molecular Construction
N-term
IL-5Rα (D18-H339)
Accession # P21183
6*His
C-term
Synonyms
Interleukin-5 receptor subunit alpha; IL-5R-alpha; IL-5RA; CDw125; CD125; IL5R
AA Sequence

DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWH

Molecular Weight

Approximately 48 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-5R alpha Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-5R alpha Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72540
Quantity:
MCE Japan Authorized Agent: