IL-5R alpha Protein, Mouse (HEK293, His)

IL-5R alpha protein is a cytokine receptor that is expressed on eosinophils, basophils and B cells and is involved in inflammation and immune regulation. IL-5R alpha Protein, Mouse (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein with a C-6*His tag^[1][3].

IL-5R alpha is a type I cytokine receptor consisting of two distinct polypeptide chains, alpha and beta. alpha chain is a membrane-penetrating glycoprotein that specifically binds IL-5 and beta chain converts low affinity IL-5R to high affinity IL-5R, forming a heterodimeric receptor complex^[1].
IL-5R alpha can induce the activation of multiple intracellular signalling pathways, including JAK/STAT, RAF/MAP, Ras-Raf-ERK and phosphatidylinositol 3-kinase when its binds with IL-5^[2].
IL-5R alpha is expressed on eosinophils, basophils and B cells and affects cell survival, apoptosis, differentiation and chemotaxis^[3].

IL-5R alpha expression is increased in myeloma CD34+ cells and facilitates eosinophil production and may further promote the subsequent development of blood and tissue eosinophilia, a hallmark of allergic inflammation^[4].

IL-5R alpha plays a key role in the development of airway eosinophilia and bronchial hyperresponsiveness (BHR) in mice, but not in antigen-induced elevation of serum IgE by performing allergen induction in IL-5Rα KO-deficient mice^[5].

Mouse

HEK293

C-6*His

P21183 (D18-H339)

16192  [NCBI]

DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWH

Approximately 48 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. S Takaki, et al. A critical cytoplasmic domain of the interleukin-5 (IL-5) receptor alpha chain and its function in IL-5-mediated growth signal transduction. Mol Cell Biol. 1994 Nov;14(11):7404-17.  [Content Brief]

  [2]. R P de Groot, et al. Regulation of proliferation, differentiation and survival by the IL-3/IL-5/GM-CSF receptor family. Cell Signal. 1998 Oct;10(9):619-32.  [Content Brief]

  [3]. S C Barry, et al. Analysis of interleukin 5 receptors on murine eosinophils: a comparison with receptors on B13 cells. Cytokine. 1991 Jul;3(4):339-48.  [Content Brief]

  [4]. R Sehmi, et al. Allergen-induced increases in IL-5 receptor alpha-subunit expression on bone marrow-derived CD34+ cells from asthmatic subjects. A novel marker of progenitor cell commitment towards eosinophilic differentiation. J Clin Invest. 1997 Nov 15;100(10):2466-79.  [Content Brief]

  [5]. H Tanaka, et al. Allergen-induced airway inflammation and bronchial responsiveness in interleukin-5 receptor alpha chain-deficient mice. Clin Exp Allergy. 2000 Jun;30(6):874-85  [Content Brief]