1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. IL1RAPL1 Protein, Mouse (HEK293, Fc)

IL1RAPL1 protein inhibits N-type calcium channels, regulates secretion, and activates JNK signaling. It promotes neurite growth and bidirectionally induces presynaptic and postsynaptic differentiation by binding to PTPRD during dendritic spine formation. IL1RAPL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL1RAPL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL1RAPL1 Protein, Mouse (HEK293, Fc) is 333 a.a., with molecular weight of ~85-95 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL1RAPL1 protein inhibits N-type calcium channels, regulates secretion, and activates JNK signaling. It promotes neurite growth and bidirectionally induces presynaptic and postsynaptic differentiation by binding to PTPRD during dendritic spine formation. IL1RAPL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL1RAPL1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of IL1RAPL1 Protein, Mouse (HEK293, Fc) is 333 a.a., with molecular weight of ~85-95 kDa.

Background

The IL1RAPL1 protein appears to exert regulatory control over secretion and presynaptic differentiation by inhibiting the activity of N-type voltage-gated calcium channels. Additionally, it may activate the MAP kinase JNK, suggesting a potential role in intracellular signaling pathways. Furthermore, IL1RAPL1 is implicated in neurite outgrowth, indicating its involvement in the extension of neuronal processes. Notably, during dendritic spine formation, IL1RAPL1 can bidirectionally induce both pre- and post-synaptic differentiation of neurons through trans-synaptic binding to PTPRD. This multifaceted functionality underscores IL1RAPL1's significance in modulating various aspects of neuronal development and synaptic differentiation, with potential implications for neural circuit formation and function. Further investigation into the specific mechanisms and downstream effects of IL1RAPL1 in these processes could provide valuable insights into its role in neurodevelopment.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED50 for this effect is 20.36 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED50 for this effect is 20.36 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P59823 (R25-T357)

Gene ID
Molecular Construction
N-term
IL1RAPL1 (R25-T357)
Accession # P59823
hFc
C-term
Synonyms
Interleukin-1 Receptor Accessory Protein-Like 1; Oligophrenin-4; OPHN4
AA Sequence

RGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

Molecular Weight

Approximately 85-95 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL1RAPL1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL1RAPL1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76998
Quantity:
MCE Japan Authorized Agent: