1. Recombinant Proteins
  2. Enzymes & Regulators
  3. IMPA2 Protein, Human (His)

IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IMPA2, or inositol monophosphatase 2, is a versatile enzyme that can utilize myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzymatic diversity suggests a role in inositol metabolism and phosphate cleavage from various inositol-containing molecules. Notably, IMPA2 has been implicated as the pharmacological target for lithium (Li+) action in the brain. The association with lithium suggests a potential role in the regulation of intracellular inositol levels, emphasizing the significance of IMPA2 in cellular processes and its involvement in the therapeutic action of lithium, a widely used mood stabilizer in psychiatric treatments.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O14732-1 (M1-K288)

Gene ID
Molecular Construction
N-term
6*His
IMPA2 (M1-K288)
Accession # O14732-1
C-term
Synonyms
rHuInositol monophosphatase 2/IMPA2, His; Inositol Monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-Monophosphatase 2; Myo-Inositol Monophosphatase A2; IMPA2; IMP.18P
AA Sequence

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IMPA2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IMPA2 Protein, Human (His)
Cat. No.:
HY-P70197
Quantity:
MCE Japan Authorized Agent: