1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Integrin
  5. Integrin alpha V beta 8
  6. Integrin alpha V beta 8 Protein, Human (HEK293, His)

Integrin alpha V beta 8 Protein, Human (HEK293, His)

Cat. No.: HY-P72535
SDS COA Handling Instructions

Integrin α V beta 5 proteins, specifically the α-V (ITGAV) subunit, are multifunctional receptors for ligands such as vitronectin and fibronectin and recognize RGD sequences. ITGAV: ITGB3 binds fractalkine and acts as a coreceptor in CX3CR1-dependent signaling. Integrin alpha V beta 8 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha V beta 8 protein, expressed by HEK293 , with C-6*His labeled tag. Integrin alpha V beta 8 Protein, Human (HEK293, His), has molecular weight of 125-160 & 80-100 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Integrin α V beta 5 proteins, specifically the α-V (ITGAV) subunit, are multifunctional receptors for ligands such as vitronectin and fibronectin and recognize RGD sequences. ITGAV: ITGB3 binds fractalkine and acts as a coreceptor in CX3CR1-dependent signaling. Integrin alpha V beta 8 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha V beta 8 protein, expressed by HEK293 , with C-6*His labeled tag. Integrin alpha V beta 8 Protein, Human (HEK293, His), has molecular weight of 125-160 & 80-100 kDa, respectively.

Background

The Integrin alpha V beta 5 protein, specifically the alpha-V (ITGAV) integrin subunit, serves as a versatile receptor for a range of ligands, including vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, and vWF. Recognizing the sequence R-G-D in various ligands, ITGAV:ITGB3 binds to fractalkine, acting as a coreceptor in CX3CR1-dependent fractalkine signaling. Additionally, it forms essential binding interactions with NRG1, FGF1, FGF2, IGF1, IGF2, IL1B, PLA2G2A, fibrillin-1 (FBN1), and CD40LG, contributing to diverse signaling pathways. Notably, the ITGAV:ITGB3 or ITGAV:ITGB6 complex acts as a receptor for transforming growth factor beta-1 (TGF-beta-1), mediating its release from regulatory Latency-associated peptide (LAP) and playing a crucial role in TGF-beta-1 activation. Furthermore, ITGAV:ITGB5 functions as a receptor for Adenovirus type C during microbial infection. The integrative and multifunctional nature of Integrin alpha V beta 5 underscores its pivotal role in mediating diverse cellular responses and signaling cascades.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P06756-1 (F31-V992)&P26012-1 (E43-R684)

Gene ID

3685  [NCBI]&3696  [NCBI]

Synonyms
Integrin alpha V beta 8; ITGAV&ITGB8;  Integrin alpha V beta 8 Heterodimer;  Integrin Alpha V & Beta 8   
AA Sequence

FNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPV&EDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLR

Molecular Weight

125-160&80-100 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 100 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Integrin alpha V beta 8 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Integrin alpha V beta 8 Protein, Human (HEK293, His)
Cat. No.:
HY-P72535
Quantity:
MCE Japan Authorized Agent: