Intrinsic Factor/GIF Protein, Human (HEK293, His)

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Intrinsic Factor/GIF Protein, Human (HEK293, His) is the recombinant human-derived Intrinsic Factor/GIF protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of Intrinsic Factor/GIF Protein, Human (HEK293, His) is 399 a.a., with molecular weight of ~49 kDa.

Intrinsic Factor (GIF) stands as a key facilitator in the absorption of the essential vitamin cobalamin (Cbl) in the ileum. Its pivotal role unfolds through a well-orchestrated process, where the CBLIF-cobalamin complex, upon interaction with the Cubilin (CUBN) receptor, undergoes internalization via receptor-mediated endocytosis. This intricate interplay underscores the significance of GIF in ensuring the effective absorption of cobalamin, a crucial vitamin for various physiological processes. GIF's interaction with CUBN, particularly involving CUB domains, highlights the molecular intricacies governing this essential aspect of vitamin uptake.

Human

HEK293

C-6*His

P27352-1 (S19-Y417)

2694  [NCBI]

STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Approximately 49 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.