1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Irisin Protein, Human/Mouse/Rat (HEK293, N-His)

Irisin Protein, Human/Mouse/Rat (HEK293, N-His)

Cat. No.: HY-P72534
SDS COA Handling Instructions Technical Support

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is 112 a.a., with molecular weight of 18-28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Irisin Protein, Human/Mouse/Rat (HEK293, N-His) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE Irisin Protein, Human/Mouse/Rat (HEK293, N-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is 112 a.a., with molecular weight of 18-28 kDa.

Background

Irisin is a hormone found to be derived from the fibronectin type III domain (FNDC5) gene, which is primarily released from skeletal muscle following exercise or exposure to cold. Irisin is primarily secreted by muscle and increases with exercise. In particular, irisin has been shown to have beneficial effects on adipose tissue, brain, and bone[1]. Recombinant human/mouse/rat irisin protein (20-200 ng/ml; 24 h) had no effect on E-selectin expression at low concentrations. When HUVECs were treated with high concentrations of irisin (200 ng/ml), soluble E-selectin concentrations were similar to levels detected in controls treated with regular growth medium[2].

Biological Activity

Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

Species

Human; Rat; Mouse

Source

HEK293

Tag

N-6*His

Accession

Q8NAU1-1 (D32-E143)

Gene ID
Molecular Construction
N-term
6*His
Irisin (D32-E143)
Accession # Q8NAU1-1
C-term
Synonyms
Fibronectin type III domain-containing protein 5; Irisin; FNDC5; FRCP2
AA Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Weight

Approximately 18-30 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Irisin Protein, Human/Mouse/Rat (HEK293, N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Irisin Protein, Human/Mouse/Rat (HEK293, N-His)
Cat. No.:
HY-P72534
Quantity:
MCE Japan Authorized Agent: