Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO)

Jagged-1/JAG1 protein is a multifunctional ligand that binds to multiple Notch receptors and mediates Notch signaling.It influences cell fate decisions during hematopoiesis, spans early and late mammalian cardiovascular development, and regulates myoblast differentiation.Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Jagged-1/JAG1 protein, expressed by E.coli , with C-Myc, N-SUMO, N-10*His labeled tag.

Jagged-1 (JAG1) serves as a versatile ligand, engaging multiple Notch receptors and participating in the mediation of Notch signaling. Its involvement extends to potential roles in cell-fate decisions during hematopoiesis and spans both early and late stages of mammalian cardiovascular development. Moreover, JAG1 demonstrates the ability to modulate myoblast differentiation, emphasizing its regulatory impact on diverse cellular processes. Additionally, it may play a role in the regulation of fibroblast growth factor-induced angiogenesis. Through its interactions with NOTCH1, NOTCH2, and NOTCH3, JAG1 contributes to the complex orchestration of Notch signaling, highlighting its significance in cellular responses and developmental pathways.

Mouse

E. coli

C-Myc;N-SUMO;N-10*His

Q9QXX0 (G33-E334)

16449  [NCBI]

GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE

Approximately 53.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.