JAM-B/CD322 Protein, Mouse (HEK293, His)

JAM-B/CD322 protein regulates cellular processes through interactions with JAM3. It aids hematopoietic cell homing and retention in the bone marrow and facilitates leukocyte extravasation. JAM-B is involved in spermatogenesis, inhibits myelination, promotes myocyte fusion, and may contribute to angiogenesis. Its multifunctionality emphasizes its significance in cellular and physiological processes. JAM-B/CD322 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag. The total length of JAM-B/CD322 Protein, Mouse (HEK293, His) is 208 a.a., with molecular weight of ~37 kDa.

JAM-B/CD322 protein functions as a junctional adhesion molecule, orchestrating heterotypic cell-cell interactions with its receptor JAM3 to regulate diverse cellular processes. It plays a crucial role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. In the context of leukocyte extravasation, JAM-B is central not only to transmigration but also to tethering and rolling of leukocytes along the endothelium, processes dependent on its binding to the integrin alpha-4/beta-1. Furthermore, JAM-B is involved in spermatogenesis, mediating interactions between Sertoli and germ cells and contributing to the anchorage of germ cells onto Sertoli cells, as well as the assembly of cell polarity complexes during spermatid differentiation. Acting as an inhibitory somatodendritic cue, it prevents the myelination of non-axonal parts of neurons. Additionally, JAM-B participates in myocyte fusion during myogenesis and may play a role in angiogenesis. The multifaceted functions of JAM-B underscore its importance in various cellular and physiological processes.

Mouse

HEK293

C-His

Q9JI59 (F29-N236)

67374  [NCBI]

FSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Approximately 37 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.