Kallikrein-1 Protein, Human (244a.a, HEK293, His)

Kallikrein-1 protein cleaves bonds in kininogen to release Lys-bradykinin. It also cleaves Neisseria meningitidis NHBA in saliva during microbial infection. Kallikrein-1 Protein, Human (244a.a, HEK293, His) is the recombinant human-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Kallikrein-1 protein functions by cleaving Met-Lys and Arg-Ser bonds in kininogen, leading to the release of Lys-bradykinin. In the context of microbial infection, it plays a role in cleaving Neisseria meningitidis NHBA in saliva, with Neisseria being an obligate commensal of the nasopharyngeal mucosa.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

AAH05313.1 (P19-S262)

3816  [NCBI]

PPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS

38-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl₂, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.