Kallikrein-2 Protein, Human (HEK293, His)

The Kallikrein-2 protein is a member of the glandular kallikrein family and is critical in the enzymatic process as it selectively cleaves the Met-Lys and Arg-Ser bonds in kininogen, thereby releasing Lys-bradykinin . This proteolytic activity contributes to the production of bradykinin, a bioactive peptide with multiple roles in regulating blood pressure, inflammation, and vascular permeability. Kallikrein-2 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Kallikrein-2 is a member of the glandular kallikrein family, exhibiting enzymatic activity by cleaving Met-Lys and Arg-Ser bonds in kininogen, resulting in the release of Lys-bradykinin. As part of the kinin-kallikrein system, Kallikrein-2 contributes to the generation of bradykinin, a potent vasoactive peptide involved in the regulation of blood pressure, inflammation, and vascular permeability. By specifically cleaving these bonds in kininogen, Kallikrein-2 plays a crucial role in the controlled release of Lys-bradykinin, influencing downstream physiological processes.

Measured by its ability to cleave a flourogenic peptide substrate Z-Phe-Arg-7-amido-4-methylcoumarin (FR-AMC). The specific activity is >180 pmol/min/μg.

Human

HEK293

C-6*His

P20151-1 (P19-P261)

3817  [NCBI]

PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Approximately 32.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Acetate, 250 mM Trehalose, 0.02% Tween 80, pH 5.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.