1. Recombinant Proteins
  2. Others
  3. KCIP-1 Protein, Mouse (P.pastoris, His)

KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

TRADD functions as an adapter molecule for TNFRSF1A/TNFR1, forming a complex with the activated TNFRSF1A/TNFR1 and mediating its interaction with FADD. Overexpression of TRADD induces two major TNF-induced responses: apoptosis and activation of NF-kappa-B. The nuclear form of TRADD acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A through interaction with TRIP12, disrupting the interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A. Stimulation of TNFRSF1A leads to the formation of two distinct signaling complexes. Plasma membrane-bound complex I, composed of TNFRSF1A, TRADD, RIPK1, TRAF2, and BIRC2/c-IAP1 or BIRC3, interacts with CHUCK/IKK-alpha, IKBKB/IKK-beta, and IKBKG/IKK-gamma, promoting cell survival. Subsequently, TRADD, RIPK1, and TRAF2 dissociate from TNFRSF1A and form cytoplasmic complex II with FADD and caspase CASP8, promoting cell apoptosis. TRADD interacts with various proteins within complex I, including TNFRSF1A/TNFR1, TRAF2, kinase RIPK1, TRPC4AP, and scaffold protein DAB2IP. It also interacts with autophagy receptor SQSTM1, E3 ligase TRIP12, kinase HIPK2, and keratins KRT14, KRT18, KRT16, and KRT17. Additionally, TRADD interacts with TOMM70.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

Q9CQV8-1 (M1-N246)

Gene ID
Molecular Construction
N-term
6*His
KCIP-1 (M1-N246)
Accession # Q9CQV8-1
C-term
Synonyms
Ywhab; 14-3-3 protein beta/alpha; Protein kinase C inhibitor protein 1; KCIP-1
AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Weight

Approximately 33 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS,6% Trehalose, pH 7.4 or 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KCIP-1 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KCIP-1 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71850
Quantity:
MCE Japan Authorized Agent: