KGF-2/FGF-10 Protein, Mouse

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

Mature mouse Fibroblast Growth Factor-10 (FGF10) shares 94% and 100% amino acid sequence identity with human and rat FGF10, respectively. The mitogenic and chemotactic properties of FGF10 are critical in many tissues during embryogenesis. FGF10 induces signaling through FGF R2 (IIIb) also contributes to the progression of pancreatic cancer^[1]. FGF10 is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands^[2].

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ this effect is <85 ng/mL, corresponding to a specific activity is >1.0 × 10⁴ units/mg.

• 
  Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ this effect is 7.948 ng/mL, corresponding to a specific activity is 1.2582×10⁵ units/mg.

Mouse

E. coli

Tag Free

O35565 (S62-T209)

14165  [NCBI]

SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 800 mM NaCl, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Nomura S, et al. FGF10/FGFR2 signal induces cell migration and invasion in pancreatic cancer. Br J Cancer. 2008 Jul 22;99(2):305-13.  [Content Brief]

  [2]. Bagai S, et al. Fibroblast growth factor-10 is a mitogen for urothelial cells. J Biol Chem. 2002 Jun 28;277(26):23828-37.  [Content Brief]