1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-10
  6. KGF-2/FGF-10 Protein, Mouse

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

Background

Mature mouse Fibroblast Growth Factor-10 (FGF10) shares 94% and 100% amino acid sequence identity with human and rat FGF10, respectively. The mitogenic and chemotactic properties of FGF10 are critical in many tissues during embryogenesis. FGF10 induces signaling through FGF R2 (IIIb) also contributes to the progression of pancreatic cancer[1]. FGF10 is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands[2].

Biological Activity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 this effect is <85 ng/mL, corresponding to a specific activity is >1.0 × 104 units/mg.

  • Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 this effect is 7.948 ng/mL, corresponding to a specific activity is 1.2582×105 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O35565 (S62-T209)

Gene ID
Molecular Construction
N-term
FGF-10 (S62-T209)
Accession # O35565
C-term
Synonyms
rMuFGF-10; Keratinocyte growth factor-2; Fgf10
AA Sequence

SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 800 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

KGF-2/FGF-10 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF-2/FGF-10 Protein, Mouse
Cat. No.:
HY-P7170
Quantity:
MCE Japan Authorized Agent: