KYNU/Kynureninase Protein, Human (sf9, His)

KYNU, a multifaceted enzyme, plays a pivotal role in the catabolism of tryptophan by catalyzing the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Demonstrating a preference for the L-3-hydroxy form, KYNU exhibits cysteine-conjugate-beta-lyase activity, showcasing its versatility in various metabolic pathways. KYNU/Kynureninase Protein, Human (sf9, His) is the recombinant human-derived KYNU/Kynureninase protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of KYNU/Kynureninase Protein, Human (sf9, His) is 465 a.a., with molecular weight of ~47 kDa.

Kynureninase (KYNU) is a pivotal enzyme that catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Notably, KYNU exhibits a preference for the L-3-hydroxy form in its enzymatic activity. In addition to its role in the kynurenine pathway, KYNU displays cysteine-conjugate-beta-lyase activity, adding another layer to its functional versatility. This enzymatic versatility positions KYNU as a key player in the metabolism of tryptophan-derived compounds, highlighting its significance in regulating the levels of bioactive molecules such as anthranilic acid and 3-hydroxyanthranilic acid, and emphasizing its broader involvement in cellular processes.

Measured by its ability to oxidize 3-hydroxykynurenine.The specific activity is > 200 pmoles/min/μg.

Human

Sf9 insect cells

C-His

Q16719 (M1-N465)

8942  [NCBI]

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECF

Approximately 47 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 25% gly.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.