LDHA Protein, Mouse (HEK293, His)

LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD(+).LDHA Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDHA protein, expressed by HEK293 , with C-6*His labeled tag.

LDHA Protein, an isoform of lactate dehydrogenase, plays a critical role in cellular metabolism. It catalyzes the conversion of pyruvate to lactate, generating energy under anaerobic conditions. Understanding the functions of LDHA Protein is essential for studying metabolic disorders and developing therapeutic strategies targeting altered metabolism in cancer and other diseases.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

HEK293

C-6*His

P06151 (M1-F332)

16828  [NCBI]

MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF

Approximately 35.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 50%Glycerol, 500 mM NaCl, 5% Trehalose, 5% Mannitol, 0.01% Tween80, 1 mM EDTA, pH 9.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.