Lacritin Protein, Human (His)

Lacritin protein plays a pivotal role in modulating lacrimal acinar cell secretion. Lacritin Protein, Human (His) is the recombinant human-derived Lacritin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Lacritin Protein, Human (His) is 120 a.a., with molecular weight of ~23.0 kDa.

Lacritin protein plays a pivotal role in the modulation of secretion by lacrimal acinar cells.

Human

E. coli

N-6*His

Q9GZZ8 (A19-A138)

90070  [NCBI]

AEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

Approximately 23.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.