1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins
  4. LAG-3/CD223 LAG-3/CD223
  5. LAG-3 Protein, Cynomolgus (428a.a, HEK293, His)

LAG-3 Protein, Cynomolgus (428a.a, HEK293, His)

Cat. No.: HY-P72530
SDS COA Handling Instructions

LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation. LAG-3 Protein, Cynomolgus (428a.a, HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived LAG-3 protein, expressed by HEK293 , with N-8*His labeled tag. LAG-3 Protein, Cynomolgus (428a.a, HEK293, His), has molecular weight of 55-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $140 In-stock
50 μg $395 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation[1][2]. LAG-3 Protein, Cynomolgus (428a.a, HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived LAG-3 protein, expressed by HEK293 , with N-8*His labeled tag. LAG-3 Protein, Cynomolgus (428a.a, HEK293, His), has molecular weight of 55-65 kDa.

Background

LAG-3 Protein serves as an inhibitory receptor for antigen-activated T cells and transmits inhibitory signals after binding to ligands such as FGL1, which is a major contributor to the inhibitory function of LAG3 T cells[1][2]. Upon T cell receptor (TCR) engagement, LAG-3 Protein binds to CD3-TCR in the immune synapse and directly blocks T cell activation. LAG-3 Protein may cooperate with PDCD1/PD-1, potentially acting as a coreceptor for PD-1 and inhibiting antigen-specific T cell activation[3]. This protein negatively regulates the proliferation, activation, effector function, and homeostasis of CD8(+) and CD4(+) T cells. Furthermore, LAG-3 Protein plays a key role in immune tolerance and is constitutively expressed on a subset of regulatory T cells (Tregs), contributing to their suppressive function[4]. LAG-3 Protein acts as a negative regulator of plasmacytoid dendritic cell (pDC) activation and exhibits interaction with MHC class II (MHC-II), although the exact role of MHC-II binding remains unclear. LAG-3 may function as a ligand for MHC class II on antigen-presenting cells (APCs), potentially promoting APC activation/maturation and driving Th1 immune responses.

Species

Cynomolgus

Source

HEK293

Tag

N-8*His

Accession

XP_005570011.1 (P23-L450(P74))

Gene ID
Molecular Construction
N-term
8*His
LAG-3 (P23-L450(P74))
Accession # XP_005570011.1
C-term
Synonyms
Lymphocyte Activating 3; LAG3; LAG-3; CD223
AA Sequence

PQPGAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAPAPGHPPVPGHRPAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRSRGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPATPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQAQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPLNTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGERLLGAAVYFTELSSPGAQRSGRAPGALRAGHL

Molecular Weight

55-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LAG-3 Protein, Cynomolgus (428a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAG-3 Protein, Cynomolgus (428a.a, HEK293, His)
Cat. No.:
HY-P72530
Quantity:
MCE Japan Authorized Agent: