LAG-3 Protein, Marmoset (HEK293, His)

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived LAG-3 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of LAG-3 Protein, Marmoset (HEK293, His) is 432 a.a., with molecular weight of ~57 kDa.

LAG-3 (Lymphocyte activation gene 3) protein is an inhibitory receptor expressed on antigen-activated T-cells, delivering inhibitory signals upon binding to ligands such as FGL1. Serving as a major ligand of LAG3, FGL1 is responsible for LAG3's T-cell inhibitory function. Following T-cell receptor (TCR) engagement, LAG3 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. LAG3 may synergistically inhibit antigen-specific T-cell activation with PDCD1/PD-1, possibly acting as a coreceptor for PD-1. It negatively regulates the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Constitutively expressed on a subset of regulatory T-cells (Tregs), LAG3 contributes to their suppressive function, mediating immune tolerance. Additionally, LAG3 acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation and binds to MHC class II (MHC-II), possibly functioning as a ligand for MHC-II on antigen-presenting cells, thereby promoting APC activation/maturation and driving Th1 immune responses.

Immobilized Madarex LAG-3 MAb Human IgG1 at 2 μg/mL (100 μL/well) can bind Marmoset LAG-3 His with a linear range of 10-237 ng/mL.

• 
  Immobilized Madarex LAG-3 MAb, Human IgG1 at 2 μg/mL (100 μL/well) can bind Marmoset LAG-3, The ED₅₀ for this effect is 236.8 ng/mL.

Marmoset

HEK293

C-10*His

XP_002752325.1 (A18-H449)

100415501  [NCBI]

APVKPPQPGAEVSEVWAQEGAPAQLPCSPTIPLQDLSLLRRGGVTWQHQPDSGPPAPVPGHPPAPGPRAAAPSSSRPGPRRYTVLSVAPGGLRSGRLPLQPRVQLEERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRTLSCHLRLRVGQASMTASPAGSLRTSDWVILNCSFSRPDRPASVQWFRGGGQGRVPVQESPHHHLAESFLFLPQVSLMDSGPWGCTLTYRDGFSVSIVYNLTVLGLEPPTPLTVYAGAGSRVELPCRLPPGVGTQPFLTAKWAPPGGGPDLLVPGDNGNFTLQLEDVSQAQAGTYTCHICLQGQQLSATVTLAVITVTPKSFGSPGSLGKLLCEVTPASGQERFVWSPLDAPSQRSFPGPWLEAQDAQLLSQPWQCQLYQGERLLGAAVYFTALSSPGAQRSGRAPGALHAGH

Approximately 57 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.