LDHB Protein, Human (His)

The LDHB protein, also known as lactate dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. References indicate that the LDHB protein effectively catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. LDHB Protein, Human (His) is the recombinant human-derived LDHB protein, expressed by E. coli , with N-6*His labeled tag. The total length of LDHB Protein, Human (His) is 334 a.a., with molecular weight of ~37.0 kDa.

LDHB protein, also known as Lactate Dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. LDHB protein efficiently catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. This enzymatic activity is accompanied by the reciprocal interconversion of NADH and NAD(+), which are essential coenzymes involved in redox reactions. LDHB helps facilitate the conversion of pyruvate, a product of glycolysis, into lactate, and vice versa. This interconversion process is important for maintaining the balance of lactate and pyruvate in cells and is critical for energy production and the regulation of cellular redox state.

Measured by its ability to reduce pyruvate to lactate. The specific activity is 101589.5 pmol/min/μg, as measured under the described conditions.

Human

E. coli

N-6*His

P07195 (M1-L334)

3945  [NCBI]

MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Approximately 37.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.