LDLR Protein, Mouse (HEK293, His)

LDLR Protein crucially binds to LDL, transporting cholesterol through endocytosis. Clustering into clathrin-coated pits initiates internalization. Interactions with DAB2, LDLRAP1, ARRB1, SNX17, and immature PCSK9 contribute to its functional versatility. The NPXY motif interaction is impaired by tyrosine phosphorylation. LDLR Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDLR protein, expressed by HEK293 , with C-His labeled tag. The total length of LDLR Protein, Mouse (HEK293, His) is 769 a.a., with molecular weight of ~98-130 kDa.

The LDLR protein plays a crucial role in binding to LDL, the primary lipoprotein responsible for transporting cholesterol in the bloodstream, and facilitating its internalization into cells through endocytosis. To undergo internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, LDLR interacts with various proteins, including DAB2 and LDLRAP1 through its NPXY motif, with the interaction impaired by tyrosine phosphorylation of the NPXY motif. It also interacts with ARRB1 and SNX17, further contributing to its functional versatility. Furthermore, LDLR interacts with the immature form of PCSK9, aiding in the regulation of LDL cholesterol levels.

Immobilized Mouse LDLR at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse PCSK9. The ED₅₀ for this effect is 117.3 ng/mL.

• 
  Immobilized Mouse LDLR at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse PCSK9 . The ED₅₀ for this effect is 117.3 ng/mL.

Mouse

HEK293

C-His

P35951 (A22-R790)

16835  [NCBI]

AAEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDGDVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPDEFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSGECISLDKVCDSARDCQDWSDEPIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHRCEDIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCLTEVDTVLTTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVSHQVQGDMAGRGNEEQPHGMR

Approximately 98-130 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.