1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Leptin
  5. Leptin Protein, Mouse (His)

Leptin Protein, Mouse (His)

Cat. No.: HY-P70704A
SDS COA Handling Instructions

Leptin is a key regulator of energy balance and body weight and binds to LEPR receptors in multiple tissues.It controls appetite in the hypothalamus and affects bone mass, hormone regulation, and reproductive function.Leptin Protein, Mouse (His) is the recombinant mouse-derived Leptin protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $30 In-stock
10 μg $50 In-stock
50 μg $85 In-stock
100 μg $110 In-stock
250 μg $150 In-stock
500 μg $190 In-stock
1 mg $260 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Leptin is a key regulator of energy balance and body weight and binds to LEPR receptors in multiple tissues.It controls appetite in the hypothalamus and affects bone mass, hormone regulation, and reproductive function.Leptin Protein, Mouse (His) is the recombinant mouse-derived Leptin protein, expressed by E.coli , with N-6*His labeled tag.

Background

Leptin, a key regulator in the orchestration of energy balance and body weight, exerts comprehensive effects once released into circulation by binding to its receptor, LEPR, present in diverse tissues. In the hypothalamus, it acts as an appetite-regulating factor, inducing a decrease in food intake and an increase in energy consumption through the modulation of anorexinogenic and orexigenic neuropeptides. Leptin further extends its influence beyond appetite control, regulating bone mass, hypothalamo-pituitary-adrenal hormones, and impacting reproductive function. In peripheral tissues, it enhances basal metabolism, influences pancreatic beta-cell function, and exhibits pro-angiogenic properties. Within the arcuate nucleus of the hypothalamus, leptin activates POMC neurons and inhibits NPY neurons, orchestrating the release of anorexigenic and orexigenic peptides, respectively. Additionally, leptin plays a modulatory role in nutrient absorption, reducing glucose uptake in the intestine. It functions as a growth factor, activating various signaling pathways to regulate gene expression involved in cell cycle control, apoptosis, and angiogenesis. In innate immunity, leptin modulates neutrophil activity, enhances macrophage function, and promotes a pro-inflammatory response. In adaptive immunity, it influences T-cell responses, promoting T helper-1 cell immune responses and regulating CD4(+)CD25(-) T-cell proliferation through MTOR signaling pathway activation.

Biological Activity

1.Fully biologically active determined by the dose dependent proliferation of MCF-7 cells. The ED50 for this effect is ≤1.680 ng/mL, corresponding to a specific activity is ≥5.95×105 units/mg. 2.Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human Leptin R. The ED50 for this effect is 0.4384 ng/mL.

  • Fully biologically active determined by the dose dependent proliferation of MCF-7 cells. The ED50 for this effect is 1.680 ng/mL, corresponding to a specific activity is 5.95×105 units/mg.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q544U0 (V22-C167)

Gene ID
Molecular Construction
N-term
6*His
Leptin (V22-C167)
Accession # Q544U0
C-term
Synonyms
Leptin; Obese Protein; Obesity Factor; LEP; OB; OBS
AA Sequence

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Weight

Approximately 16-18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Leptin Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Leptin Protein, Mouse (His)
Cat. No.:
HY-P70704A
Quantity:
MCE Japan Authorized Agent: