LHPP Protein, Human (His-SUMO)

LHPP Protein, a phosphatase, exhibits broad substrate specificity, efficiently hydrolyzing imidodiphosphate, 3-phosphohistidine, and 6-phospholysine. It can also hydrolyze inorganic diphosphate, albeit less efficiently. LHPP Protein, Human (His-SUMO) is the recombinant human-derived LHPP protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

LHPP Protein is a phosphatase with the capacity to hydrolyze imidodiphosphate, 3-phosphohistidine, and 6-phospholysine, showcasing broad substrate specificity. Additionally, it possesses the ability to hydrolyze inorganic diphosphate, albeit with lower efficiency.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-SUMO;N-6*His

Q9H008-1 (M1-K270)

64077  [NCBI]

MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK

Approximately 45.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.