1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. LIF Protein, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE LIF Protein, Human (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

Background

The LIF protein possesses the capacity to induce terminal differentiation in leukemic cells. Its diverse range of activities encompasses the induction of hematopoietic differentiation in both normal and myeloid leukemia cells, prompting neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. These multifaceted activities underscore LIF's role in influencing cellular differentiation across various cell types and physiological contexts.

Biological Activity

1. Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells and the ED50 is typically 0.2-0.8 ng/mL.
2. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50  for this effect is 0.004-0.1 ng/mL.
3.Immobilized Human LIF at 2 μg/mL (100 μl/Well) on the plate. Dose response curve for Human LIF R, hFc Tag with the EC50 of ≤0.12 μg/mL determined by ELISA.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.004534 ng/mL, corresponding to a specific activity is 2.206×108 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

P15018-1 (S23-F202)

Gene ID
Molecular Construction
N-term
LIF (S23-F202)
Accession # P15018-1
C-term
Synonyms
LIF; Leukemia inhibitory factor; HILDA; D factor; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Weight

Approximately 24-55 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE or Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM Tris, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LIF Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIF Protein, Human (HEK293)
Cat. No.:
HY-P73276
Quantity:
MCE Japan Authorized Agent: