1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85i/LIR-6 LIR-6
  5. LILRA1/LIR-6/CD85i Protein, Human (HEK293, His)

LILRA1/LIR-6/CD85i Protein, Human (HEK293, His)

Cat. No.: HY-P77440
COA Handling Instructions

LILRA1/LIR-6/CD85i protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and possibly influencing immune activity. LILRA1/LIR-6/CD85i Protein, Human (HEK293, His) is the recombinant human-derived LILRA1/LIR-6/CD85i protein, expressed by HEK293 , with C-His labeled tag. The total length of LILRA1/LIR-6/CD85i Protein, Human (HEK293, His) is 445 a.a., with molecular weight of ~50 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $53 In-stock
10 μg $90 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LILRA1/LIR-6/CD85i protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and possibly influencing immune activity. LILRA1/LIR-6/CD85i Protein, Human (HEK293, His) is the recombinant human-derived LILRA1/LIR-6/CD85i protein, expressed by HEK293 , with C-His labeled tag. The total length of LILRA1/LIR-6/CD85i Protein, Human (HEK293, His) is 445 a.a., with molecular weight of ~50 KDa.

Background

LILRA1/LIR-6/CD85i Protein appears to serve as a receptor for class I MHC antigens, indicating a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and potentially influencing immune activities. Operating as a receptor, LILRA1 may contribute to the fine-tuned recognition of cells presenting class I MHC antigens, thereby playing a key role in immune surveillance. Further investigation into LILRA1's interactions and its impact on immune signaling could deepen our understanding of its function as a receptor and its potential implications in immune surveillance and regulatory processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LILRA1 at 2 μg/mL (100 μL/well) can bind Human ANGPTL7, The ED50 for this effect is 1.143 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human LILRA1 at 2 μg/mL (100 μL/well) can bind Human ANGPTL7, The ED50 for this effect is 1.143 μg/mL.
Species

Human

Source

HEK293

Tag

C-His

Accession

O75019-1 (P17-N461)

Gene ID
Molecular Construction
N-term
LILRA1 (P17-N461)
Accession # O75019
His
C-term
Synonyms
Leukocyte immunoglobulin-like receptor subfamily A member 1; CD85 antigen-like family member I
AA Sequence

PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN

Molecular Weight

Approximately 70-75 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRA1/LIR-6/CD85i Protein, Human (HEK293, His)
Cat. No.:
HY-P77440
Quantity:
MCE Japan Authorized Agent: