Lithostathine-1/Reg1 Protein, Mouse (His-SUMO)

Lithostathine-1/Reg1 Protein potentially inhibits spontaneous calcium carbonate precipitation.Lithostathine-1/Reg1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Lithostathine-1/Reg1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Lithostathine-1/Reg1 protein may function as an inhibitor of spontaneous calcium carbonate precipitation.

Mouse

E. coli

N-His;N-SUMO

P43137 (22Q-165G)

19692  [NCBI]

QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

Approximately 32 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.