1. Recombinant Proteins
  2. Others
  3. LMAN2 Protein, Human (HEK293, His)

LMAN2 Protein, an intracellular lectin, interacts with N-acetyl-D-galactosamine and high-mannose type glycans. This protein is integral to the transport and sorting of glycoproteins with high mannose-type glycans within the early secretory pathway, contributing significantly to cellular processes. LMAN2 Protein, Human (HEK293, His) is the recombinant human-derived LMAN2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LMAN2 Protein, Human (HEK293, His) is 278 a.a., with molecular weight of ~34.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LMAN2 Protein, an intracellular lectin, interacts with N-acetyl-D-galactosamine and high-mannose type glycans. This protein is integral to the transport and sorting of glycoproteins with high mannose-type glycans within the early secretory pathway, contributing significantly to cellular processes. LMAN2 Protein, Human (HEK293, His) is the recombinant human-derived LMAN2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LMAN2 Protein, Human (HEK293, His) is 278 a.a., with molecular weight of ~34.8 kDa.

Background

LMAN2 functions as an intracellular lectin, exerting its influence within the early secretory pathway. This protein demonstrates interaction capabilities with N-acetyl-D-galactosamine and exhibits an affinity for high-mannose type glycans, potentially extending its binding repertoire to O-linked glycans. LMAN2 plays a crucial role in the transport and sorting mechanisms associated with glycoproteins that bear high mannose-type glycans, thereby contributing to the intricate orchestration of cellular processes within the secretory pathway.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q12907 (D45-R322)

Gene ID
Molecular Construction
N-term
LMAN2 (D45-R322)
Accession # Q12907
6*His
C-term
Synonyms
Vesicular Integral-Membrane Protein VIP36; Glycoprotein GP36b; Lectin Mannose-Binding 2; Vesicular Integral-Membrane Protein 36; VIP36; LMAN2; C5orf8
AA Sequence

DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWR

Molecular Weight

Approximately 34.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 10 mM GSH, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

LMAN2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LMAN2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71151
Quantity:
MCE Japan Authorized Agent: