1. Recombinant Proteins
  2. Others
  3. LRG1 Protein, Human (HEK293, Fc-His)

Leucine-rich alpha-2-glycoprotein (encoded by LRG1) is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (KD: 2.32 µM) and modulate the TGFβ pathway. LRG1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived LRG1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Leucine-rich alpha-2-glycoprotein (encoded by LRG1) is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (KD: 2.32 µM) and modulate the TGFβ pathway[1][2][3]. LRG1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived LRG1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Background

Leucine-rich alpha-2-glycoprotein (encoded by LRG1), an approximately 50 kDa glycoprotein, is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (KD: 2.32 µM) and modulate the TGFβ pathway, and promotes ECM integrity by activating the TGF-beta signaling pathway in fibroblasts[1]. LRG1 is usually secreted by neutrophils undergoing differentiation and by liver cells[2].
Besides, LRG1 enhances TGFβ1-smad1/5/8 signaling in the presence of endoglin in endothelial cells. LRG1 also promotes TGFβ1-induced apoptosis[3].

Species

Human

Source

HEK293

Tag

C-hFc;C-6*His

Accession

P02750/AAH70198.1 (V36-Q347)

Gene ID
Molecular Construction
N-term
LRG1 (V36-Q347)
Accession # P02750/AAH70198.1
hFc-6*His
C-term
Synonyms
rHuLeucine-rich alpha-2-glycoprotein/LRG1, Fc-His; Leucine-rich alpha-2-glycoprotein; LRG and LRG1
AA Sequence

VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Molecular Weight

65-90 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 200 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

LRG1 Protein, Human (HEK293, Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LRG1 Protein, Human (HEK293, Fc-His)
Cat. No.:
HY-P70175
Quantity:
MCE Japan Authorized Agent: