LRG1 Protein, Human (HEK293, Fc-His)

Leucine-rich alpha-2-glycoprotein (encoded by LRG1) is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (K_D: 2.32 µM) and modulate the TGFβ pathway^[1][2][3]. LRG1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived LRG1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Leucine-rich alpha-2-glycoprotein (encoded by LRG1), an approximately 50 kDa glycoprotein, is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (K_D: 2.32 µM) and modulate the TGFβ pathway, and promotes ECM integrity by activating the TGF-beta signaling pathway in fibroblasts^[1]. LRG1 is usually secreted by neutrophils undergoing differentiation and by liver cells^[2].
Besides, LRG1 enhances TGFβ1-smad1/5/8 signaling in the presence of endoglin in endothelial cells. LRG1 also promotes TGFβ1-induced apoptosis^[3].

Human

HEK293

C-hFc;C-6*His

P02750/AAH70198.1 (V36-Q347)

116844  [NCBI]

VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

65-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 200 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.