1. Recombinant Proteins
  2. Others
  3. LRRC25 Protein, Human (HEK293, His)

LRRC25 Protein, Human (HEK293, His)

Cat. No.: HY-P70876
Handling Instructions

The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LRRC25 Protein, Human (HEK293, His) is 145 a.a., with molecular weight of 25-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LRRC25 Protein, Human (HEK293, His) is 145 a.a., with molecular weight of 25-40 kDa.

Background

LRRC25 emerges as a crucial regulator in dampening RLR-mediated type I interferon signaling pathways, exerting its inhibitory influence by orchestrating the autophagic degradation of RIGI. The protein, through its specific interaction with ISG15-associated RIGI, facilitates the binding of RIGI to the autophagic cargo receptor p62/SQSTM1, leading to the selective autophagic degradation of RIGI. In addition to its role in immune modulation, LRRC25 plays a pivotal part in restraining the NF-kappa-B signaling pathway and mitigating inflammatory responses by fostering the degradation of p65/RELA. Notably, LRRC25 engages in direct interactions with RIGI, SQSTM1, and p65/RELA, underscoring its multifaceted involvement in orchestrating protein degradation processes and fine-tuning crucial cellular signaling cascades.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8N386 (L21-T165)

Gene ID
Molecular Construction
N-term
LRRC25 (L21-T165)
Accession # Q8N386
6*His
C-term
Synonyms
Leucine-rich repeat-containing protein 25; Monocyte and plasmacytoid-activated protein; MAPA; FLJ38116; UNQ6169/PRO20174
AA Sequence

LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASAT

Molecular Weight

25-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LRRC25 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LRRC25 Protein, Human (HEK293, His)
Cat. No.:
HY-P70876
Quantity:
MCE Japan Authorized Agent: