LRRC25 Protein, Human (HEK293, His)

The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LRRC25 Protein, Human (HEK293, His) is 145 a.a., with molecular weight of 25-40 kDa.

LRRC25 emerges as a crucial regulator in dampening RLR-mediated type I interferon signaling pathways, exerting its inhibitory influence by orchestrating the autophagic degradation of RIGI. The protein, through its specific interaction with ISG15-associated RIGI, facilitates the binding of RIGI to the autophagic cargo receptor p62/SQSTM1, leading to the selective autophagic degradation of RIGI. In addition to its role in immune modulation, LRRC25 plays a pivotal part in restraining the NF-kappa-B signaling pathway and mitigating inflammatory responses by fostering the degradation of p65/RELA. Notably, LRRC25 engages in direct interactions with RIGI, SQSTM1, and p65/RELA, underscoring its multifaceted involvement in orchestrating protein degradation processes and fine-tuning crucial cellular signaling cascades.

Human

HEK293

C-6*His

Q8N386 (L21-T165)

126364  [NCBI]

LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASAT

25-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.