1. Recombinant Proteins
  2. Others
  3. LSAMP Protein, Human (HEK293, His)

LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LSAMP Protein, Human (HEK293, His) is 287 a.a., with molecular weight of 45-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LSAMP Protein, Human (HEK293, His) is 287 a.a., with molecular weight of 45-65 kDa.

Background

LSAMP Protein serves as a crucial mediator in orchestrating selective neuronal growth and precise axon targeting, playing a pivotal role in guiding developing axons and facilitating the remodeling of mature circuits within the limbic system. The protein's significance extends to its essential role in ensuring the normal growth of the hippocampal mossy fiber projection, thereby contributing to the intricate architecture of neural pathways. Through its involvement in these processes, LSAMP emerges as a key player in the intricate orchestration of neural development, impacting both the establishment of neuronal connections during development and the adaptive changes within mature circuits in the limbic system.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q13449 (V29-N315)

Gene ID
Molecular Construction
N-term
LSAMP (V29-N315)
Accession # Q13449
6*His
C-term
Synonyms
rHuLimbic system-associated membrane protein/LSAMP, His ; Limbic system-associated membrane protein; LSAMP; IgLON family member 3
AA Sequence

VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN

Molecular Weight

45-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

LSAMP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LSAMP Protein, Human (HEK293, His)
Cat. No.:
HY-P70414
Quantity:
MCE Japan Authorized Agent: