LSM1 Protein, Human (His)

LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation.Likely part of an LSm subunit-containing complex involved in general mRNA degradation.It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase.The LSm subunits collectively form a donut-shaped heteromer.LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E.coli , with C-6*His labeled tag.

LSM1 (Like-Sm Protein 1) takes center stage in the intricate process of histone mRNA degradation, a unique task among eukaryotic mRNAs due to their lack of polyadenylation. This essential protein is likely a crucial component of an LSm subunit-containing complex involved in the broader mechanism of mRNA degradation, contributing to the maintenance of cellular homeostasis. In particular, LSM1 forms a significant interaction with SLBP, emphasizing its role during the S phase when histone mRNA undergoes rapid degradation. The LSm subunits, when assembled, create a heteromer with a distinctive donut shape, further highlighting the structural complexity associated with their functional involvement in mRNA degradation pathways.

Human

E. coli

C-6*His

O15116 (M1-Y133)

27257  [NCBI]

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Approximately 19.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.