LSM3 Protein, Human (His)

The LSM3 protein plays a crucial role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and as part of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex (including LSM3) specifically binds to the 3'-end U strand of U6 snRNA. LSM3 Protein, Human (His) is the recombinant human-derived LSM3 protein, expressed by E. coli , with N-His labeled tag.

LSM3 protein serves a pivotal role in pre-mRNA splicing as a crucial component of the U4/U6-U5 tri-snRNP complex, which participates in spliceosome assembly and the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex, in which LSM3 is a constituent, specifically binds to the 3'-terminal U-tract of U6 snRNA. This intricate machinery, composed of various snRNPs and associated proteins, including LSM3, LSM2, LSM4, LSM5, LSM6, LSM7, and LSM8, forms a ring-shaped subcomplex within the U4/U6-U5 tri-snRNP complex. These interactions emphasize LSM3's essential contribution to the complex orchestration of spliceosome assembly and pre-mRNA processing.

Human

E. coli

N-His

P62310 /NP_055278.1(M1-G102)

27258  [NCBI]

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.