1. Recombinant Proteins
  2. Others
  3. LSM4 Protein, Human (His)

The LSM4 protein plays a crucial role in pre-mRNA splicing, participating in the U4/U6-U5 tri-snRNP complex during spliceosome assembly, and as a component of the precatalytic spliceosome (spliceosome B complex).In the heptameric LSM2-8 complex, LSM4 specifically binds to the 3' U region of U6 snRNA.LSM4 Protein, Human (His) is the recombinant human-derived LSM4 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LSM4 protein plays a crucial role in pre-mRNA splicing, participating in the U4/U6-U5 tri-snRNP complex during spliceosome assembly, and as a component of the precatalytic spliceosome (spliceosome B complex).In the heptameric LSM2-8 complex, LSM4 specifically binds to the 3' U region of U6 snRNA.LSM4 Protein, Human (His) is the recombinant human-derived LSM4 protein, expressed by E.coli , with N-6*His labeled tag.

Background

LSM4 protein plays a crucial role in pre-mRNA splicing, functioning as a key component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and the precatalytic spliceosome (spliceosome B complex). Alongside LSM2, LSM3, LSM5, LSM6, LSM7, and LSM8, LSM4 forms the heptameric LSM2-8 complex, which specifically binds to the 3'-terminal U-tract of U6 snRNA. This complex is an integral part of the U4/U6-U5 tri-snRNP complex, a fundamental building block in the intricate machinery orchestrating spliceosome assembly. The U4/U6-U5 tri-snRNP complex comprises various snRNAs and associated proteins, underscoring LSM4's essential contribution to the complex and highly regulated process of pre-mRNA splicing.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y4Z0 (M1-Q139)

Gene ID
Molecular Construction
N-term
6*His
LSM4 (M1-Q139)
Accession # Q9Y4Z0
C-term
Synonyms
U6 snRNA-Associated Sm-Like Protein LSm4; Glycine-Rich Protein; GRP; LSM4
AA Sequence

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LSM4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LSM4 Protein, Human (His)
Cat. No.:
HY-P70944
Quantity:
MCE Japan Authorized Agent: