1. Recombinant Proteins
  2. Others
  3. Lumican/LUM Protein, Human (HEK293, His)

Lumican, also known as LUM protein, is a protein with the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. Lumican/LUM Protein, Human (HEK293, His) is the recombinant human-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Lumican/LUM Protein, Human (HEK293, His) is 320 a.a., with molecular weight of 40-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lumican, also known as LUM protein, is a protein with the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. Lumican/LUM Protein, Human (HEK293, His) is the recombinant human-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Lumican/LUM Protein, Human (HEK293, His) is 320 a.a., with molecular weight of 40-60 kDa.

Background

Lumican, also known as LUM protein, is a protein that possesses the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. The binding of lumican to laminin suggests its involvement in the regulation of cellular interactions and tissue organization. However, further research is required to fully understand the specific mechanisms and functional implications of lumican's interaction with laminin, as well as its potential role in various physiological and pathological processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P51884 (Q19-N338)

Gene ID
Molecular Construction
N-term
Lumican (Q19-N338)
Accession # P51884
6*His
C-term
Synonyms
rHuLumican/LUM, His; Lumican; Keratan Sulfate Proteoglycan Lumican; KSPG Lumican; LUM; LDC; SLRR2D
AA Sequence

QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

Molecular Weight

40-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Lumican/LUM Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lumican/LUM Protein, Human (HEK293, His)
Cat. No.:
HY-P70369
Quantity:
MCE Japan Authorized Agent: