Lumican/LUM Protein, Human (HEK293, His)

Lumican, also known as LUM protein, is a protein with the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. Lumican/LUM Protein, Human (HEK293, His) is the recombinant human-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Lumican/LUM Protein, Human (HEK293, His) is 320 a.a., with molecular weight of 40-60 kDa.

Lumican, also known as LUM protein, is a protein that possesses the ability to bind to laminin. Laminin is a key component of the extracellular matrix, a complex network of molecules that provides structural support to tissues. The binding of lumican to laminin suggests its involvement in the regulation of cellular interactions and tissue organization. However, further research is required to fully understand the specific mechanisms and functional implications of lumican's interaction with laminin, as well as its potential role in various physiological and pathological processes.

Human

HEK293

C-6*His

P51884 (Q19-N338)

4060  [NCBI]

QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

40-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.