1. Recombinant Proteins
  2. Others
  3. Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His)

Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His)

Cat. No.: HY-P70217
Handling Instructions Technical Support

LY6H mediates the myelin trophic and neurotrophic effects of PSAP/Prosaposin protein through GPR37 and GPR37L1 receptors. Ligand-mediated internalization of these receptors results in ERK phosphorylation signaling. Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is the recombinant human-derived Lymphocyte antigen 6H/LY6H protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is 90 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LY6H mediates the myelin trophic and neurotrophic effects of PSAP/Prosaposin protein through GPR37 and GPR37L1 receptors. Ligand-mediated internalization of these receptors results in ERK phosphorylation signaling. Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is the recombinant human-derived Lymphocyte antigen 6H/LY6H protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) is 90 a.a., with molecular weight of ~18.0 kDa.

Background

PSAP/Prosaposin protein acts as a myelinotrophic and neurotrophic factor, exerting its effects through G-protein-coupled receptors, GPR37 and GPR37L1, which undergo ligand-mediated internalization followed by ERK phosphorylation signaling. Furthermore, saposin-A and saposin-C, components of PSAP, stimulate the hydrolysis of glucosylceramide and galactosylceramide by their respective enzymes. Notably, saposin-C is proposed to combine with the enzyme and acidic lipid to form an activated complex, suggesting a mechanism of action that involves complex formation rather than substrate solubilization.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O94772 (L26-G115)

Gene ID
Molecular Construction
N-term
LY6H (L26-G115)
Accession # O94772
6*His
C-term
Synonyms
rHuLymphocyte antigen 6H/LY6H, His; Lymphocyte Antigen 6H; Ly-6H; LY6H
AA Sequence

LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lymphocyte antigen 6H/LY6H Protein, Human (HEK293, His)
Cat. No.:
HY-P70217
Quantity:
MCE Japan Authorized Agent: