Marapsin/Pancreasin Protein, Human (HEK293, His)

Marapsin/pancreatin protein shows predominant expression in the pancreas, emphasizing its central role in pancreatic tissue. As a key member within this organ, marapsin/pancreatin may play a crucial role in pancreatic function and processes. Marapsin/Pancreasin Protein, Human (HEK293, His) is the recombinant human-derived Marapsin/Pancreasin protein, expressed by HEK293 , with C-His labeled tag.

The Marapsin/Pancreasin protein, is predominantly expressed in the pancreas. This specific tissue distribution suggests a specialized role for Marapsin/Pancreasin within pancreatic function. Given its association with the pancreas, this protein likely plays a role in processes related to pancreatic physiology, such as enzyme secretion, digestion, or maintenance of tissue homeostasis. Further exploration of Marapsin/Pancreasin's molecular functions and interactions within the pancreas could provide valuable insights into its contributions to pancreatic health and function, potentially uncovering its involvement in key aspects of digestive processes or regulatory mechanisms specific to this vital organ.

Measured by its ability to cleave a colorimetric peptide substrate, Z-GR-SBzl, in the presence of DTNB that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 12844.08 pmol/min/μg,

Human

HEK293

C-6*His

Q9BQR3 (A23-K290)

83886  [NCBI]

ATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQPARLGGQK

Approximately 35-45 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.