1. Recombinant Proteins
  2. Others
  3. MCEMP1 Protein, Human (HEK293, Fc)

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells and plays a critical in allergic and inflammatory lung diseases. MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes. MCEMP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MCEMP1 protein, expressed by HEK293 , with N-mFc labeled tag. The total length of MCEMP1 Protein, Human (HEK293, Fc) is 81 a.a., with molecular weight of 40-50 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells and plays a critical in allergic and inflammatory lung diseases. MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes[1][2]. MCEMP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MCEMP1 protein, expressed by HEK293 , with N-mFc labeled tag. The total length of MCEMP1 Protein, Human (HEK293, Fc) is 81 a.a., with molecular weight of 40-50 kDa.

Background

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells, such as lung-resident mast cells and alveolar macrophages. MCEMP1 is an inducible genes in many inflammatory diseases, and plays a critical in allergic and inflammatory lung diseases[1].
In function, MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 signals through its cytoplasmic immunoreceptor tyrosine-based activation motif and forms a complex with KIT to enhance its autophosphorylation and activation[1]. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes[2].Human MCEMP1 shares about 40% aa sequence identity with mouse and rat. Rat MCEMP1 shares about 78% aa sequence identity with mouse.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

Q8IX19-1 (K107-Q187)

Gene ID
Molecular Construction
N-term
mFc
MCEMP1 (K107-Q187)
Accession # Q8IX19
C-term
Synonyms
Mast cell-expressed membrane protein 1; C19orf59
AA Sequence

KNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MCEMP1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCEMP1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77080
Quantity:
MCE Japan Authorized Agent: